PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 817aa    MW: 91931.1 Da    PI: 9.136
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046340.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.16e-2296191199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f+k  + +  ++++rl+lp +f++e+g++k++  ++ l  ++g +W  +l  ++++gr++l++GWk+FvkangLk+g++v+++l + +++ +v++
  Csa16g046340.1  96 FIKFRLAPVDGRHCRLRLPMQFTRENGINKPG--KIYLLGKDGSKWLANLLLENTRGRMTLGDGWKSFVKANGLKTGESVTLRLCW-EDTIPVLS 187
                     77888888999****************99776..8*************************************************99.77778988 PP

                     EE-S CS
              B3  96 vfrk 99 
                     ++++
  Csa16g046340.1 188 LCSE 191
                     8875 PP

2B368.31e-21249339498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++++d+lk+grl+lp +f++e++++k++  ++tl  ++g +W v l    k+gr+ l+kGWk+F+kangL++ D+++++l++ +++++ ++++r
  Csa16g046340.1 249 LTITPDSLKHGRLRLPLQFMAENNMDKPG--EITLLGKDGAKWLVSLL-LEKRGRMSLGKGWKDFAKANGLRTDDSITLELIW-ENATPILHLLR 339
                     6789*******************999766..8***************5.66667889**************************.77778887765 PP

3B366.15.2e-21580663187
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     f++ ++++d+l++grl+lp +f++e++++k++  ++tl  ++g +W v l    ++gr+ l+kGWk F+k+ngLk+gD+++F+ +g+
  Csa16g046340.1 580 FLTLTITPDSLRHGRLRLPLEFMTENNMNKPG--EITLLGKNGAKWLVSLL-LERRGRMSLGKGWKIFAKENGLKTGDSITFESIGQ 663
                     778899********************999766..8***************5.55556789***********************7764 PP

4B344.23.4e-14725814497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ++++   + g l lp kf++ ++++k +    tl  + g +W  +l    ++g +vl++GWk+F++ang+  g+++++++ ++++++l +k++
  Csa16g046340.1 725 LTLTPEDVRDGTLHLPSKFMRINDINKSG--RTTLLGRGGMKWFAYL--LPRDGIVVLGNGWKGFCEANGVMLGESFILEFLHKEDTNLIFKFY 814
                     455566666778********999988655..69999***********..*******************************99999999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.79E-2193190IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-2095191IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.0E-2996192IPR003340B3 DNA binding domain
CDDcd100174.16E-1996190No hitNo description
PfamPF023624.4E-2196191IPR003340B3 DNA binding domain
PROSITE profilePS5086314.97496192IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.2E-21238335IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-22242337IPR015300DNA-binding pseudobarrel domain
CDDcd100179.63E-20245339No hitNo description
SMARTSM010193.8E-30246341IPR003340B3 DNA binding domain
PROSITE profilePS5086315.312246341IPR003340B3 DNA binding domain
PfamPF023628.2E-21248339IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-21575671IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-22576671IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.989580675IPR003340B3 DNA binding domain
SMARTSM010191.3E-26580675IPR003340B3 DNA binding domain
CDDcd100172.37E-18580672No hitNo description
PfamPF023629.2E-20580663IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-16714808IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-18716804IPR015300DNA-binding pseudobarrel domain
CDDcd100176.04E-14721815No hitNo description
SMARTSM010191.1E-15722815IPR003340B3 DNA binding domain
PROSITE profilePS5086313.155722816IPR003340B3 DNA binding domain
PfamPF023621.2E-13722814IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MANSLILGSP MNPERDLMIQ VSDHQDNNIE FQRKKKVKQN NTETEPDYSC FNAHVTASSQ  60
QSGRLYLPQD FTSSIGLIRQ CSKSPPQIIS SSDKNFIKFR LAPVDGRHCR LRLPMQFTRE  120
NGINKPGKIY LLGKDGSKWL ANLLLENTRG RMTLGDGWKS FVKANGLKTG ESVTLRLCWE  180
DTIPVLSLCS EEYITNTRVG KKCSEASEKE PLPTVPETKK DETSSWKREN NHMRCIDSTS  240
PSQNHILTLT ITPDSLKHGR LRLPLQFMAE NNMDKPGEIT LLGKDGAKWL VSLLLEKRGR  300
MSLGKGWKDF AKANGLRTDD SITLELIWEN ATPILHLLRI ESSSGRGECD FSKESLPIEP  360
NSGNKARNSD NNREESKKYP PGSRESSSAI QNQFMALTRP SGIISQGALH LQTNEVFIYR  420
NEGGNMLQIS DLGPYFFGIR DVPAPSSNND HDRIGNISMK MHPHLRKEAG LSSSYDGDDH  480
DNFERPSKKR VRKNSPETEE NYSSDHARFG AHVTTTSNLH TNELRLAAKE CFPIGPSVEK  540
KISEGENSKD KINMVESSSC GREENHLRCI ASISPSQNRF LTLTITPDSL RHGRLRLPLE  600
FMTENNMNKP GEITLLGKNG AKWLVSLLLE RRGRMSLGKG WKIFAKENGL KTGDSITFES  660
IGQNASHVLS LLYIESSSVR GQSDFPKESH FTNREEKNSQ ELEKRTYFPR IQNSSSDIQN  720
RFLTLTLTPE DVRDGTLHLP SKFMRINDIN KSGRTTLLGR GGMKWFAYLL PRDGIVVLGN  780
GWKGFCEANG VMLGESFILE FLHKEDTNLI FKFYSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472479.10.0PREDICTED: B3 domain-containing protein REM-like 1
SwissprotQ8S8E80.0REML1_ARATH; B3 domain-containing protein REM-like 1
TrEMBLR0FUN00.0R0FUN0_9BRAS; Uncharacterized protein (Fragment)
STRINGAT2G24690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150791619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24690.10.0B3 family protein